SAP Web Service from .NET via WCF -

-

i'm trying consume sap web service .net via wcf. i've generated proxy , have configured app.config file.

here test code:

webservicesap.ztest_rfcclient mywcfservice = new webservicesap.ztest_rfcclient("myendpoint");  mywcfservice.clientcredentials.username.username = "<username>"; mywcfservice.clientcredentials.username.password = "<password>";  webservicesap.ztestrfc parameter = new webservicesap.ztestrfc(); parameter.testinput = "this simple test";  webservicesap.ztestrfcresponse response = mywcfservice.ztestrfc(parameter);  console.writeline(reponse.testoutput); console.readline();

the ztestrfc sap method simple function accepts input string, , outputs: "result: <the input string>"

when call ztestrfc method, got null value in variable response. soap messages seem fine.

soap request

<messagelogtracerecord> <httprequest xmlns="http://schemas.microsoft.com/2004/06/servicemodel/management/messagetrace"> <method>post</method> <querystring></querystring> <webheaders> <vsdebuggercausalitydata>uidpoxjmi5ncdatnipm/wfar52kaaaaatqhavnnwjeempmexoyr/vn7oxwcjzltnnikldpg5migacqaa</vsdebuggercausalitydata> </webheaders> </httprequest> <s:envelope xmlns:s="http://schemas.xmlsoap.org/soap/envelope/"> <s:header> <action s:mustunderstand="1" xmlns="http://schemas.microsoft.com/ws/2005/05/addressing/none">urn:sap-com:document:sap:soap:functions:mc-style:ztest_rfc:ztestrfcrequest</action> </s:header> <s:body xmlns:xsi="http://www.w3.org/2001/xmlschema-instance" xmlns:xsd="http://www.w3.org/2001/xmlschema"> <ztestrfc xmlns="urn:sap-com:document:sap:soap:functions:mc-style"> <testinput xmlns="">this simple test</testinput> </ztestrfc> </s:body> </s:envelope> </messagelogtracerecord>

soap response

<messagelogtracerecord> <httpresponse xmlns="http://schemas.microsoft.com/2004/06/servicemodel/management/messagetrace"> <statuscode>ok</statuscode> <statusdescription>ok</statusdescription> <webheaders> <content-length>359</content-length> <content-type>text/xml; charset=utf-8</content-type> <set-cookie>mysapsso2=ajexmdabaaxqmdewmda1msagicacaamwndadaahemtegicagiaqaddiwmtaxmtewmtiwoquabaaaaaggaafycqabu%2f8a9jcb8wyjkozihvcnaqccoihlmihiagebmqswcqyfkw4dahofadalbgkqhkig9w0bbwexgciwgb8caqewezaomqwwcgydvqqdewnqmtecaqawcqyfkw4dahofakbdmbggcsqgsib3dqejazelbgkqhkig9w0bbwewhayjkozihvcnaqkfmq8xdtewmtexmdeymdk0ofowiwyjkozihvcnaqkemryefjc%2fnflvbnu1zaodwtlpapes8sapmakgbyqgsm44bamemdauahubs844bob%2f8ngeguepmglakbveggucfqfls6hii%21bwt1mejmqvabd3%2fjfvmw%3d%3d; path=/; domain=.<domain ... ></set-cookie> <server>sap netweaver application server / abap 700</server> </webheaders> </httpresponse> <soap-env:envelope xmlns:soap-enc="http://schemas.xmlsoap.org/soap/encoding/" xmlns:soap-env="http://schemas.xmlsoap.org/soap/envelope/"> <s:header xmlns:s="http://schemas.xmlsoap.org/soap/envelope/"></s:header> <soap-env:body> <rfc:ztestrfcresult xmlns:rfc="urn:sap-com:document:sap:soap:functions:mc-style"> <testoutput xmlns="">result:</testoutput> </rfc:ztestrfcresult> </soap-env:body> </soap-env:envelope> </messagelogtracerecord>

i don't know happening. ideas?

thanks in advance

offhand, looks when created proxy (btw, technique did use that?), sap told .net parameter , response in namespace, you're sending parameter in empty namespace (""). may why sap service returning "result:". may getting null response because proxy may expecting testoutput element in different namespace.

look @ generated proxy classes , see namespaces expected.


Comments

Post a Comment

Popular posts from this blog

android - Spacing between the stars of a rating bar? -

-
ho can set spacing beween stars? thats ratingbar: ratingbar = (ratingbar) inflater.inflate(r.layout.ratingbar, null); ratingbar.setlayoutparams(new layoutparams(layoutparams.wrap_content, layoutparams.wrap_content)); the layout: <?xml version="1.0" encoding="utf-8"?> <ratingbar xmlns:android="http://schemas.android.com/apk/res/android" style="@style/mystyle" android:layout_alignparentright="true" android:layout_height="19dp" android:layout_width="wrap_content" android:numstars="5"> </ratingbar> the style: <style name="mystyle" parent="@android:style/widget.ratingbar"> <item name="android:progressdrawable">@drawable/android_r2_ratingstar_yellow</item> <item name="android:indeterminatedrawable">@drawable/android_r2_ratingstar_grey</item> </style> thanks, cheers you have
Read more

html - Instapaper-like algorithm -

-
does of algorithm extracts contents webpage? instapaper ? there 2 steps instapaper does: find main content block on page (excluding headers, footers, menus etc) from content block extract , format text to find content block (typically html block element, div containing key page text content) instapaper uses algorithm 1 used readability . can @ source of readability.js see what's going on, @ core tries find area on page highest text/link ratio, although has other simple scoring metrics (e.g. off top of head, things ratio of text commas, para elements etc) go heuristics. once have identified root node element, relevant content, you'll need format it, if want can pull node element containing text out of source document , insert yours, in reality you'll want remove existing styles , apply own, standard , feel. if want output nice text-only can use jericho's renderer . update1 : should mention else instapaper - follow 'pagination' links (
Read more

c# - How to execute a particular part of code asynchronously in a class -

-
i creating speech recognition engine that's going respond user commands.i have created button enable , disable speech recognition per user convenience.i have used dispose() of speech engine disable speech recoginition.here code private void button1_click(object sender, routedeventargs e) { engineon = !engineon; if (engineon) { speechengine = speech.createspeechengine(); //speech class creates , returns new speech engine. speechengine.audiolevelupdated += new eventhandler<audiolevelupdatedeventargs>(speechengine_audiolevelupdated); // use system's default microphone speechengine.setinputtodefaultaudiodevice(); speechengine.loadgrammar(new dictationgrammar()); // start listening speechengine.recognizeasync(recognizemode.multiple); } else { speechclass.myengine.dispose(); } } but disposal of speech obj
Read more